PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI10G11440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 286aa    MW: 30664.4 Da    PI: 4.5916
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI10G11440.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.4e-13351148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd+l+++  +++G g +W + +  +g+ R++ +c+srw++yl
  OMERI10G11440.1  3 KGKWSKEEDDLIKNHMEKYGIGrSWQALSDALGLQRCGRSCRSRWLNYL 51
                     79******************999************************97 PP

2Myb_DNA-binding32.71.8e-1058101247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g +++ E+ ++ +   + G+  W++Ia+ ++ gRt+  +k++w++ 
  OMERI10G11440.1  58 GDFSPAEERIICKMYSKKGSS-WSAIAAQLP-GRTDLAVKNYWNST 101
                      679****************99.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.125155IPR017930Myb domain
SMARTSM007172.4E-10253IPR001005SANT/Myb domain
SuperFamilySSF466891.21E-24298IPR009057Homeodomain-like
PfamPF002495.9E-12351IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-19458IPR009057Homeodomain-like
CDDcd001676.45E-9551No hitNo description
PROSITE profilePS5129415.53556106IPR017930Myb domain
SMARTSM007176.4E-1156104IPR001005SANT/Myb domain
PfamPF002491.2E-958101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2059105IPR009057Homeodomain-like
CDDcd001671.40E-760102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MKKGKWSKEE DDLIKNHMEK YGIGRSWQAL SDALGLQRCG RSCRSRWLNY LRPGLKHGDF  60
SPAEERIICK MYSKKGSSWS AIAAQLPGRT DLAVKNYWNS TLKKRHRPAA SASATTSSDD  120
DDDVDDATPP GLALVVYSEG STAAAAAAGE LAPYSVSSPA AIADAAEEEG EEEPIAAVPI  180
STCILALPPP PPPPPPPPPP SNATGGEVSI PCFPFSPLPF IEPDLPELTW TTDLDDIAAG  240
FAAAADDACR YPKRPHPITP DSPRLPKLPA IAGFDDVQSF LSWFDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-23110525127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0798880.0AC079888.10 Oryza sativa chromosome 10 BAC OSJNBa0078O01 genomic sequence, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661280.16e-76PREDICTED: transcription factor RAX2-like
TrEMBLA0A0E0EZJ70.0A0A0E0EZJ7_9ORYZ; Uncharacterized protein
STRINGBGIOSGA031610-PA1e-142(Oryza sativa Indica Group)
STRINGLOC_Os10g35660.11e-142(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122282638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37780.17e-41myb domain protein 87